VPS28 Antibody - N-terminal region : FITC

VPS28 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP56850_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a protein involved in endosomal sorting of cell surface receptors via a multivesicular body/late endosome pathway. The encoded protein is one of the three subunits of the ESCRT-I complex (endosomal complexes required for transport) invol

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human VPS28

Key Reference: Hui,E.K., (2006) J. Virol. 80 (5), 2291-2308

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: MFHGIPATPGIGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Vacuolar protein sorting-associated protein 28 homolog

Protein Size: 221

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56850_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56850_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51160
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×