VPS29 Antibody - N-terminal region : HRP

VPS29 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56858_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene belongs to a group of vacuolar protein sorting (VPS) genes that, when functionally impaired, disrupt the efficient delivery of vacuolar hydrolases. The protein encoded by this gene is a component of a large multimeric complex, termed the retrome

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human VPS29

Key Reference: Hierro,A., (2007) Nature 449 (7165), 1063-1067

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: LCTGNLCTKESYDYLKTLAGDVHIVRGDFDENLNYPEQKVVTVGQFKIGL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Vacuolar protein sorting-associated protein 29

Protein Size: 182

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56858_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56858_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51699
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×