VPS37C Antibody - N-terminal region : FITC

VPS37C Antibody - N-terminal region : FITC
Artikelnummer
AVIARP57073_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: VPS37C is a subunit of ESCRT-I (endosomal sorting complex required for transport I), a complex in the class E vacuolar protein sorting (VPS) pathway required for sorting ubiquitinated transmembrane proteins into internal vesicles of multivesicular bodies

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human VPS37C

Key Reference: Eastman,S.W., (2005) J. Biol. Chem. 280 (1), 628-636

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: LQLEREMALATNRSLAERNLEFQGPLEISRSNLSDRYQELRKLVERCQEQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Vacuolar protein sorting-associated protein 37C

Protein Size: 355

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57073_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57073_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55048
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×