VPS52 Antibody - middle region : FITC

VPS52 Antibody - middle region : FITC
Artikelnummer
AVIARP57644_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a protein that is similar to the yeast suppressor of actin mutations 2 gene. The yeast protein forms a subunit of the tetrameric Golgi-associated retrograde protein complex that is involved in vesicle trafficking from from both early and late endosomes, back to the trans-Golgi network. This gene is located on chromosome 6 in a head-to-head orientation with the gene encoding ribosomal protein S18.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human VPS52

Molecular Weight: 82kDa

Peptide Sequence: Synthetic peptide located within the following region: RYWEQVLALLWPRFELILEMNVQSVRSTDPQRLGGLDTRPHYITRRYAEF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Vacuolar protein sorting-associated protein 52 homolog

Protein Size: 723

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57644_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57644_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 6293
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×