VPS54 Antibody - N-terminal region : FITC

VPS54 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP56167_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: VPS54 may be involved in retrograde transport from early and late endosomes to late Golgi.This gene encodes for a protein that in yeast forms part of a trimeric vacuolar-protein-sorting complex that is required for retrograde transport of proteins from prevacuoles to the late Golgi compartment. As in yeast, mammalian Vps54 proteins contain a coiled-coil region and dileucine motifs. Alternative splicing results in multiple transcript variants encoding different isoforms.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human VPS54

Key Reference: Liewen,H., (2005) Exp. Cell Res. 306 (1), 24-34

Molecular Weight: 107kDa

Peptide Sequence: Synthetic peptide located within the following region: FYLPQISKEHFTVYQQEISQREKIHERCKNICPPKDTFERTLLHTHDKSR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Vacuolar protein sorting-associated protein 54

Protein Size: 977

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56167_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56167_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51542
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×