VSIG1 Antibody - N-terminal region : FITC

VSIG1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55832_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human VSIG1

Key Reference: Scanlan,M.J., (er) Cancer Immun. 6, 2 (2006)

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: SIYFSQGGQAVAIGQFKDRITGSNDPGNASITISHMQPADSGIYICDVNN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: V-set and immunoglobulin domain-containing protein 1

Protein Size: 387

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55832_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55832_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Pig (Porcine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 340547
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×