VSIG1 Antibody - N-terminal region : HRP

VSIG1 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP55832_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human VSIG1

Key Reference: Scanlan,M.J., (er) Cancer Immun. 6, 2 (2006)

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: SIYFSQGGQAVAIGQFKDRITGSNDPGNASITISHMQPADSGIYICDVNN

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: V-set and immunoglobulin domain-containing protein 1

Protein Size: 387

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55832_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55832_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Pig (Porcine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 340547
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×