Vwa5a Antibody - C-terminal region : Biotin

Vwa5a Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP55094_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Vwa5a may play a role in tumorigenesis as a tumor suppressor. Altered expression of this protein and disruption of the molecular pathway it is involved in may contribute directly to or modify tumorigenesis.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 87kDa

Peptide Sequence: Synthetic peptide located within the following region: VLSSFTAFIAINKELNKPVQGPLAHRVIPRPVMAGSSSMRFYSSFSGGFK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: von Willebrand factor A domain-containing protein 5A

Protein Size: 793

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55094_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55094_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 67776
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×