WDR51B Antibody - N-terminal region : Biotin

WDR51B Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP55620_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: WDR51B contains 7 WD repeats. The function of the WDR51B protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human WDR51B

Key Reference: Higa,L.A., (2006) Nat. Cell Biol. 8 (11), 1277-1283

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: GNLLASASRDRTVRLWIPDKRGKFSEFKAHTAPVRSVDFSADGQFLATAS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: POC1 centriolar protein homolog B

Protein Size: 478

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55620_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55620_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 282809
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×