WDR53 Antibody - middle region : HRP

WDR53 Antibody - middle region : HRP
Artikelnummer
AVIARP55842_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human WDR53

Key Reference: Higa,L.A., (2006) Nat. Cell Biol. 8 (11), 1277-1283

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: NLLASADDSGAIKILDLENKKVIRSLKRHSNICSSVAFRPQRPQSLVSCG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: WD repeat-containing protein 53

Protein Size: 358

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55842_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55842_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 348793
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×