WDR55 Antibody - middle region : Biotin

WDR55 Antibody - middle region : Biotin
Artikelnummer
AVIARP57011_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: WDR55 is a nucleolar protein that acts as a modulator of rRNA synthesis. WDR55 plays a central role during organogenesis.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human WDR55

Key Reference: Kimura,K., (2006) Genome Res. 16 (1), 55-65

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: AKKLLLTASGDGCLGIFNIKRRRFELLSEPQSGDLTSVTLMKWGKKVACG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: WD repeat-containing protein 55

Protein Size: 383

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57011_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57011_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 54853
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×