WDR5B Antibody - N-terminal region : Biotin

WDR5B Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP57325_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This intronless gene encodes a protein containing several WD40 repeats. WD repeats are approximately 30- to 40-amino acid domains containing several conserved residues, including a trp-asp at the C-terminal end. The encoded protein may mediate protein-protein interactions.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human WDR5B

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: DVAWSSDSSRLVSASDDKTLKLWDVRSGKCLKTLKGHSNYVFCCNFNPPS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: WD repeat-containing protein 5B

Protein Size: 330

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57325_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57325_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 54554
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×