WFDC1 Antibody - middle region : Biotin

WFDC1 Antibody - middle region : Biotin
Artikelnummer
AVIARP57526_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene encodes a member of the WAP-type four disulfide core domain family. The WAP-type four-disulfide core domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family members. The encoded protein shares 81% amino acid identity with the rat ps20 protein, which was originally identified as a secreted growth inhibitor. This gene is mapped to chromosome 16q24, an area of frequent loss of heterozygosity in cancers, including prostate, breast and hepatocellular cancers and Wilms' tumor. Owing to its location and a possible growth inhibitory property of its gene product, this gene is suggested to be a tumor suppressor gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human WFDC1

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: VAEGIPNRGQCVKQRRQADGRILRHKLYKEYPEGDSKNVAEPGRGQQKHF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: WAP four-disulfide core domain protein 1

Protein Size: 220

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57526_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57526_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Pig (Porcine), Dog (Canine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 58189
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×