Wnt8b Antibody - C-terminal region : Biotin

Wnt8b Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP58100_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Wnt8b is a ligand for members of the frizzled family of seven transmembrane receptors. It may play an important role in the development and differentiation of certain forebrain structures, notably the hippocampus.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Wnt8b

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: SISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein Wnt-8b

Protein Size: 350

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58100_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58100_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 22423
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×