Wnt8b Antibody - C-terminal region : HRP

Wnt8b Antibody - C-terminal region : HRP
Artikelnummer
AVIARP58100_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Wnt8b is a ligand for members of the frizzled family of seven transmembrane receptors. It may play an important role in the development and differentiation of certain forebrain structures, notably the hippocampus.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Wnt8b

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: SISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRR

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Protein Wnt-8b

Protein Size: 350

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58100_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58100_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 22423
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×