XAF1 Antibody - middle region : Biotin

XAF1 Antibody - middle region : Biotin
Artikelnummer
AVIARP56969_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: X-linked inhibitor of apoptosis (XIAP; MIM 300079) is a potent member of the IAP family. All members of this family possess baculoviral IAP (BIR) repeats, cysteine-rich domains of approximately 80 amino acids that bind and inhibit caspases (e.g., CASP3; M

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human XAF1

Key Reference: Bai,Y., (2008) J. Biol. Chem. 283 (11), 6832-6842

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: SRTELCQGCGQFIMHRMLAQHRDVCRSEQAQLGKGERISAPEREIYCHYC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: XIAP-associated factor 1

Protein Size: 301

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56969_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56969_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 54739
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×