XPNPEP3 Antibody - N-terminal region : Biotin

XPNPEP3 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP57593_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human XPNPEP3

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: PVPERRIPNRYLGQPSPFTHPHLLRPGEVTPGLSQVEYALRRHKLMSLIQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Probable Xaa-Pro aminopeptidase 3

Protein Size: 507

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57593_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57593_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 63929
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×