XRRA1 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: XRRA1 may be involved in the response of cells to X-ray radiation.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human XRRA1

Molecular Weight: 90kDa

Peptide Sequence: Synthetic peptide located within the following region: MAFSGIYKLDDGKPYLNNCFPARNLLRVPEEGQGHWLVVQKGNLKKKPKG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: X-ray radiation resistance-associated protein 1

Protein Size: 792

Purification: Affinity Purified

• Artikelnummer: AVIARP53441_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53441_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 143570
• Wirt: Rabbit
• Konjugat: Conjugated, FITC