YTHDF3 Antibody - N-terminal region : FITC

YTHDF3 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55530_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: YTHDF3 contains 1 YTH domain. The functions of YTHDF3 remain unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human YTHDF3

Key Reference: Mehrle,A., Nucleic Acids Res. 34 (DATABASE ISSUE), D415-D418 (2006)

Molecular Weight: 64kDa

Peptide Sequence: Synthetic peptide located within the following region: QPGALGNTPPFLGQHGFNFFPGNADFSTWGTSGSQGQSTQSSAYSSSYGY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: YTH domain family protein 3

Protein Size: 585

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55530_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55530_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 253943
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×