ZADH2 Antibody - N-terminal region : FITC

ZADH2 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55747_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZADH2

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: FVGVNASDINYSAGRYDPSVKPPFDIGFEGIGEVVALGLSASARYTVGQA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Zinc-binding alcohol dehydrogenase domain-containing protein 2

Protein Size: 377

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55747_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55747_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 284273
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×