ZADH2 Antibody - N-terminal region : HRP

ZADH2 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP55746_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The exact functions of ZADH2 remain unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZADH2

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: MLRLVPTGARAIVDMSYARHFLDFQGSAIPQAMQKLVVTRLSPNFREAVT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Zinc-binding alcohol dehydrogenase domain-containing protein 2

Protein Size: 377

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55746_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55746_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 284273
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×