Zar1l Antibody - C-terminal region : FITC

Zar1l Antibody - C-terminal region : FITC
Artikelnummer
AVIARP58201_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Zar1l

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: SQLLLPTWSRDREEQFPRLKELGEEYAHSPQDRKGKQFLELKYGYFHCKD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein Zar1l Ensembl ENSMUSP00000114116

Protein Size: 291

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58201_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58201_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Mouse (Murine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 545824
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×