ZCCHC13 Antibody - middle region : FITC

ZCCHC13 Antibody - middle region : FITC
Artikelnummer
AVIARP55945_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZCCHC13

Key Reference: Lim,J., (2006) Cell 125 (4), 801-814

Molecular Weight: 18kDa

Peptide Sequence: Synthetic peptide located within the following region: GKLGHIQKDCAQVKCYRCGEIGHVAINCSKARPGQLLPLRQIPTSSQGMS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Zinc finger CCHC domain-containing protein 13

Protein Size: 166

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55945_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55945_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 389874
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×