ZCCHC14 Antibody - N-terminal region : Biotin

ZCCHC14 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP55181_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: ZCCHC14 contains 1 CCHC-type zinc finger. The function of ZCCHC14 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZCCHC14

Key Reference: Nakajima,D., (2002) DNA Res. 9 (3), 99-106

Molecular Weight: 100kDa

Peptide Sequence: Synthetic peptide located within the following region: RYLASLPSHVLKNDHVRRFLSTSSPPQQLQSPSPGNPSLSKVGTVMGVSG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Zinc finger CCHC domain-containing protein 14

Protein Size: 949

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55181_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55181_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23174
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×