ZDHHC24 Antibody - middle region : Biotin

ZDHHC24 Antibody - middle region : Biotin
Artikelnummer
AVIARP55989_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The specific function of the protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZDHHC24

Key Reference: Clark,H.F., (2003) Genome Res. 13 (10), 2265-2270

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: QHSYDLGPCHNLQAALGPRWALVWLWPFLASPLPGDGITFQTTADVGHTA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Probable palmitoyltransferase ZDHHC24

Protein Size: 284

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55989_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55989_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 254359
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×