Zfp566 Antibody - middle region : FITC

Zfp566 Antibody - middle region : FITC
Artikelnummer
AVIARP58056_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the following sequence YECKECGKAFSSGSNFTQHQRIHTGEKPYECKECGNAFSQSSQLIKHQRI

Molecular Weight: 45 kDa

Peptide Sequence: Synthetic peptide located within the following region: YECKECGKAFSSGSNFTQHQRIHTGEKPYECKECGNAFSQSSQLIKHQRI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein Zfp566 Ensembl ENSRNOP00000051339

Protein Size: 386

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58056_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58056_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 502316
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×