ZFPL1 Antibody - middle region : FITC

ZFPL1 Antibody - middle region : FITC
Artikelnummer
AVIARP58101_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: ZFPL1 is expressed strongly in the exocrine pancreas as a 1.4-kb polyadenylated RNA encoding a putative protein of 310 amino acids.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZFPL1

Key Reference: Chiu,C.F., (2008) EMBO J. 27 (7), 934-947

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: LLQRAGLLLLLGLLGFLALLALMSRLGRAAADSDPNLDPLMNPHIRVGPS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Zinc finger protein-like 1

Protein Size: 310

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58101_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58101_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 7542
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×