ZFPL1 Antibody - middle region : HRP

ZFPL1 Antibody - middle region : HRP
Artikelnummer
AVIARP58101_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: ZFPL1 is expressed strongly in the exocrine pancreas as a 1.4-kb polyadenylated RNA encoding a putative protein of 310 amino acids.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZFPL1

Key Reference: Chiu,C.F., (2008) EMBO J. 27 (7), 934-947

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: LLQRAGLLLLLGLLGFLALLALMSRLGRAAADSDPNLDPLMNPHIRVGPS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Zinc finger protein-like 1

Protein Size: 310

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58101_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58101_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 7542
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×