ZHX3 Antibody - middle region : Biotin

ZHX3 Antibody - middle region : Biotin
Artikelnummer
AVIARP57983_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This protein is a member of the zinc fingers and homeoboxes (ZHX) gene family. The encoded protein contains two C2H2-type zinc fingers and five homeodomains and forms a dimer with itself or with zinc fingers and homeoboxes family member 1. In the nucleus, the dimerized protein interacts with the A subunit of the ubiquitous transcription factor nuclear factor-Y and may function as a transcriptional repressor.This gene encodes a member of the zinc fingers and homeoboxes (ZHX) gene family. The encoded protein contains two C2H2-type zinc fingers and five homeodomains and forms a dimer with itself or with zinc fingers and homeoboxes family member 1. In the nucleus, the dimerized protein interacts with the A subunit of the ubiquitous transcription factor nuclear factor-Y and may function as a transcriptional repressor.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZHX3

Key Reference: Liu,G., (2006) J. Biol. Chem. 281 (51), 39681-39692

Molecular Weight: 105kDa

Peptide Sequence: Synthetic peptide located within the following region: ETKMTRREIDSWFSERRKKVNAEETKKAEENASQEEEEAAEDEGGEEDLA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Zinc fingers and homeoboxes protein 3

Protein Size: 956

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57983_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57983_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Rabbit, Guinea Pig
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23051
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×