ZMAT5 Antibody - C-terminal region : Biotin

ZMAT5 Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP57334_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The function of the protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human ZMAT5

Molecular Weight: 18kDa

Peptide Sequence: Synthetic peptide located within the following region: RAKRLSSAPSSRAEPIRTTVFQYPVGWPPVQELPPSLRAPPPGGWPLQPR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Zinc finger matrin-type protein 5

Protein Size: 170

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57334_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57334_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55954
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×