ZNF134 Antibody - middle region : FITC

ZNF134 Antibody - middle region : FITC
Artikelnummer
AVIARP58103_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: ZNF134 is a candidate transcription factor.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZNF134

Key Reference: Tommerup,N. (1995) Genomics 27 (2), 259-264

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: TLGGCQQKAIHSKRKTHRSTESGDAFHGEQMHYKCSECGKAFSRKDTLVQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Zinc finger protein 134

Protein Size: 427

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58103_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58103_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Pig (Porcine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 7693
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×