ZNF174 Antibody - middle region : Biotin

ZNF174 Antibody - middle region : Biotin
Artikelnummer
AVIARP58108_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Zinc finger protein 174.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZNF174

Key Reference: Rush,J., (2005) Nat. Biotechnol. 23 (1), 94-101

Molecular Weight: 46kDa

Peptide Sequence: Synthetic peptide located within the following region: DNKENPQQEGAKGAKPCAVSAGRSKGNGLQNPEPRGANMSEPRLSRRQVS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Zinc finger protein 174

Protein Size: 407

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58108_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58108_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 7727
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×