ZNF174 Antibody - middle region : HRP

ZNF174 Antibody - middle region : HRP
Artikelnummer
AVIARP58108_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Zinc finger protein 174.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZNF174

Key Reference: Rush,J., (2005) Nat. Biotechnol. 23 (1), 94-101

Molecular Weight: 46kDa

Peptide Sequence: Synthetic peptide located within the following region: DNKENPQQEGAKGAKPCAVSAGRSKGNGLQNPEPRGANMSEPRLSRRQVS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Zinc finger protein 174

Protein Size: 407

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58108_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58108_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 7727
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×