ZNF257 Antibody - N-terminal region : FITC

ZNF257 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP57954_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of ZNF257 has not yet been determined.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF257

Key Reference: Han,Z.G., (1999) J. Biol. Chem. 274 (50), 35741-35748

Molecular Weight: 66kDa

Peptide Sequence: Synthetic peptide located within the following region: PPVMCSHIAEDLCPERDIKYFFQKVILRRYDKCEHENLQLRKGCKSVDEC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Zinc finger protein 257

Protein Size: 563

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57954_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57954_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 113835
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×