ZNF257 Antibody - N-terminal region : HRP

ZNF257 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP57954_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of ZNF257 has not yet been determined.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF257

Key Reference: Han,Z.G., (1999) J. Biol. Chem. 274 (50), 35741-35748

Molecular Weight: 66kDa

Peptide Sequence: Synthetic peptide located within the following region: PPVMCSHIAEDLCPERDIKYFFQKVILRRYDKCEHENLQLRKGCKSVDEC

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Zinc finger protein 257

Protein Size: 563

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57954_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57954_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 113835
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×