ZNF334 Antibody - N-terminal region : HRP

ZNF334 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP58055_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: ZNF334 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 14 C2H2-type zinc fingers and 1 KRAB domain. ZNF334 may be involved in transcriptional regulation.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF334

Key Reference: Deloukas,P., (2001) Nature 414 (6866), 865-871

Molecular Weight: 80kDa

Peptide Sequence: Synthetic peptide located within the following region: KMKKFQIPVSFQDLTVNFTQEEWQQLDPAQRLLYRDVMLENYSNLVSVGY

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Zinc finger protein 334

Protein Size: 680

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58055_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58055_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55713
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×