ZNF44 Antibody - N-terminal region : Biotin

ZNF44 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP58043_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: ZNF44 may be involved in transcriptional regulation.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZNF44

Molecular Weight: 64kDa

Peptide Sequence: Synthetic peptide located within the following region: NLRRNPRCDVVERFGKSKDGSQCGETLSQIRNSIVNKNTPARVDACGSSV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Zinc finger protein 44

Protein Size: 589

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58043_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58043_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51710
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×