ZNF442 Antibody - middle region : Biotin

ZNF442 Antibody - middle region : Biotin
Artikelnummer
AVIARP58189_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: ZNF442 Belongs to the krueppel C2H2-type zinc-finger protein family. It contains 16 C2H2-type zinc fingers and 1 KRAB domain. ZNF442 may be involved in transcriptional regulation.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZNF442

Key Reference: Kimura,K., (2006) Genome Res. 16 (1), 55-65

Molecular Weight: 73kDa

Peptide Sequence: Synthetic peptide located within the following region: YLRHERTHTGEKPYECKHCSKAFPDYSSYVRHERTHTGEKPYKCKRCGRA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Zinc finger protein 442

Protein Size: 627

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58189_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58189_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 79973
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×