ZNF764 Antibody - N-terminal region : Biotin

ZNF764 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP58137_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: ZNF764 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 7 C2H2-type zinc fingers and 1 KRAB domain. ZNF764 may be involved in transcriptional regulation.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF764

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: APPLAPLPPRDPNGAGPEWREPGAVSFADVAVYFCREEWGCLRPAQRALY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Zinc finger protein 764

Protein Size: 408

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58137_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58137_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rabbit
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 92595
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×