ZNF768 Antibody - N-terminal region : FITC

ZNF768 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP58118_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: ZNF768 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 10 C2H2-type zinc fingers. It may be involved in transcriptional regulation.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF768

Key Reference: Beausoleil,S.A., (2004) Proc. Natl. Acad. Sci. U.S.A. 101 (33), 12130-12135

Molecular Weight: 60kDa

Peptide Sequence: Synthetic peptide located within the following region: DSQSPEFESQSPRYEPQSPGYEPRSPGYEPRSPGYESESSRYESQNTELK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Zinc finger protein 768

Protein Size: 540

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58118_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58118_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Pig (Porcine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 79724
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×