ZPBP2 Antibody - middle region : FITC

ZPBP2 Antibody - middle region : FITC
Artikelnummer
AVIARP53477_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: ZPBP2 may be implicated in gamete interaction during fertilization.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZPBP2

Molecular Weight: 35kDa

Peptide Sequence: Synthetic peptide located within the following region: VRLDSCRPGFGKNERLHSNCASCCVVCSPATFSPDVNVTCQTCVSVLTYG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Zona pellucida-binding protein 2

Protein Size: 315

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53477_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53477_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 124626
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×