ZPBP2 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: ZPBP2 may be implicated in gamete interaction during fertilization.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZPBP2

Molecular Weight: 35kDa

Peptide Sequence: Synthetic peptide located within the following region: VRLDSCRPGFGKNERLHSNCASCCVVCSPATFSPDVNVTCQTCVSVLTYG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Zona pellucida-binding protein 2

Protein Size: 315

Purification: Affinity Purified

• Artikelnummer: AVIARP53477_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53477_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 124626
• Wirt: Rabbit
• Konjugat: Conjugated, HRP