ZPBP2 Antibody - N-terminal region : Biotin

ZPBP2 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP53476_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: ZPBP2 may be implicated in gamete interaction during fertilization.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZPBP2

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: MMRTCVLLSAVLWCLTGVQCPRFTLFNKKGFIYGKTGQPDKIYVELHQNS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Zona pellucida-binding protein 2

Protein Size: 338

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53476_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53476_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 124626
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×