ZSWIM3 Antibody - N-terminal region : Biotin

ZSWIM3 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP53534_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZSWIM3

Key Reference: Deloukas,P., (2001) Nature 414 (6866), 865-871

Molecular Weight: 77kDa

Peptide Sequence: Synthetic peptide located within the following region: SVRFHNLNHGTSIREDILYVQVKFVCIRTQSNRKRTREADMCPAYLLLRY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Zinc finger SWIM domain-containing protein 3

Protein Size: 696

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53534_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53534_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 140831
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×