ZXDA antibody

Calculated MW: 85

Form: Liquid

Buffer (with preservative): PBS, 2% Sucrose, 0.09% Sodium Azide.

Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)

Uniprot ID: P98168

Antigen Species: Human

Immunogen: A synthetic peptide directed towards the middle region of human ZXDA, within the following region: PAKAEWSVHPNSDFFGQEGETQFGFPNAAGNHGSQKERNLITVTGSSFLV.

Purification: Purified by affinity chromatography

Conjugation: Unconjugated

Full Name: zinc finger X-linked duplicated A

• Artikelnummer: GTX04842-100
• Hersteller: GeneTex
• Hersteller Artikelnummer: GTX04842-100
• Verpackungseinheit: 100 μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Isotyp: IgG
• Human Gene ID: 7789
• Wirt: Rabbit
• Konjugat: Unconjugated