Clone Name:
Calculated MW: 42
Form: Liquid
Buffer (with preservative): PBS, 2% sucrose, 0.09% sodium azide.
Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)
Background: This gene encodes a protein containing multiple transmembrane helices. It is a selective surface protein marker of brite/beige adipocytes, which may coexist with classical brown adipocytes in brown adipose tissue. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Dec 2015]
Uniprot ID: Q6ZUK4
Antigen Species: Human
Immunogen: A synthetic peptide directed towards the C-terminal region of Human TMEM26 (RSQSEGLKGEHGCRAQTSESGPSQRDWQNESKEGLAIPLRGSPVTSDDSH)
Purification: Purified by affinity chromatography
Conjugation: Unconjugated
Full Name: transmembrane protein 26