AATF Antibody (aa171-220)

Specificity: Human AATF

Antibody Modification: Unconjugated

Antigen Modification: aa171-220

Presentation: PBS, 0.09% sodium azide, 2% sucrose

Immunogen: Synthetic peptide located between aa171-220 of human AATF (Q9NY61, NP_036270) within the region EEEEDEESGMEEGDDAEDSQGESEEDRAGDRNSEDDGVVMTFSSVKVSEE. Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Rabbit (100%); Monkey, Elephant (92%); Marmoset (91%); Galago (85%); Bat, Horse (84%).

Gene: AATF

Description: AATF antibody LS-B17062 is an unconjugated rabbit polyclonal antibody to human AATF (aa171-220). Validated for IHC and WB.

Synonyms: AATF, CHE1, DED, Rb-binding protein Che-1, CHE-1, Protein AATF

Recommended Storage: Short term: Store at 2-8°C. Long term: Aliquot and store at -20°C. Avoid freeze/thaw cycles.

• SKU: LIFLS-B17062-50
• Manufacturer: LSBio
• Manufacturer SKU: LS-B17062-50
• Package Unit: 50 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Immunohistochemistry (paraffin), Western Blotting, Immunohistochemistry
• Isotype: IgG
• Human Gene ID: 26574
• Host: Rabbit
• Conjugate: Unconjugated