ABHD15 Antibody - middle region : HRP

ABHD15 Antibody - middle region : HRP
SKU
AVIARP53459_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LOC116236

Key Reference: Clark,H.F., (2003) Genome Res. 13 (10), 2265-2270

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: LLALERGYYPVIFHRRGHHGCPLVSPRLQPFGDPSDLKEAVTYIRFRHPA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Abhydrolase domain-containing protein 15

Protein Size: 468

Purification: Affinity Purified
More Information
SKU AVIARP53459_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53459_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 116236
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×