ABHD7 Antibody - N-terminal region : Biotin

ABHD7 Antibody - N-terminal region : Biotin
SKU
AVIARP55651_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The specific function of ABHD7 is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ABHD7

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: HCYVRIKDSGLRFHYVAAGERGKPLMLLLHGFPEFWYSWRYQLREFKSEY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Epoxide hydrolase 4

Protein Size: 362

Purification: Affinity Purified
More Information
SKU AVIARP55651_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55651_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish
Clonality Polyclonal
Application Western Blotting
Human Gene ID 253152
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×