ABHD7 Antibody - N-terminal region : HRP

ABHD7 Antibody - N-terminal region : HRP
SKU
AVIARP55651_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of ABHD7 is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ABHD7

Key Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: HCYVRIKDSGLRFHYVAAGERGKPLMLLLHGFPEFWYSWRYQLREFKSEY

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Epoxide hydrolase 4

Protein Size: 362

Purification: Affinity Purified
More Information
SKU AVIARP55651_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55651_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish
Clonality Polyclonal
Application Western Blotting
Human Gene ID 253152
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×